WARS antibody (N-Term)

Catalog No. ABIN631021

Product Details anti-WARS Antibody

Target: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WARS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WARS antibody was raised against the N terminal of WARS

Purification: Affinity purified

Immunogen: WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WARS Blocking Peptide, catalog no. 33R-2465, is also available for use as a blocking control in assays to test for specificity of this WARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WARS

Target: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Alternative Name: WARS (WARS Products)

Synonyms: GAMMA-2 antibody, IFI53 antibody, IFP53 antibody, zgc:73274 antibody, wars antibody, MGC53671 antibody, WARS antibody, TrpRS antibody, WRS antibody, 85D-WRS antibody, CG9735 antibody, Dmel\\CG9735 antibody, WRS-85D antibody, l(3)03559 antibody, l(3)03560 antibody, l(3)3559 antibody, gamma-2 antibody, ifi53 antibody, ifp53 antibody, GB14934 antibody, ECK3371 antibody, JW3347 antibody, tryptophanyl-tRNA synthetase antibody, tryptophanyl-tRNA synthetase S homeolog antibody, Tryptophanyl-tRNA synthetase antibody, tryptophanyl-tRNA synthetase L homeolog antibody, tryptophan--tRNA ligase, cytoplasmic antibody, WARS antibody, wars antibody, wars.S antibody, Wars antibody, TrpRS antibody, wars.L antibody, LOC727582 antibody, trpS antibody, trpS2 antibody

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family.

Molecular Weight: 52 kDa (MW of target protein)