HAX1 antibody (Middle Region)
-
- Target See all HAX1 Antibodies
- HAX1 (HCLS1 Associated Protein X-1 (HAX1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HAX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HAX1 antibody was raised against the middle region of HAX1
- Purification
- Affinity purified
- Immunogen
- HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids QPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQP
- Top Product
- Discover our top product HAX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HAX1 Blocking Peptide, catalog no. 33R-7672, is also available for use as a blocking control in assays to test for specificity of this HAX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HAX1 (HCLS1 Associated Protein X-1 (HAX1))
- Alternative Name
- HAX1 (HAX1 Products)
- Synonyms
- HAX1 antibody, hax1 antibody, HCLSBP1 antibody, HS1BP1 antibody, SCN3 antibody, HAX-1 antibody, Hs1bp1 antibody, HSP1BP-1 antibody, SIG-111 antibody, Silg111 antibody, mHAX-1s antibody, HCLS1 associated protein X-1 antibody, HCLS1 associated X-1 antibody, HAX1 antibody, hax1 antibody, Hax1 antibody
- Background
- HAX1 is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-