AKAP5 antibody

Catalog No. ABIN631131

Product Details anti-AKAP5 Antibody

Target: AKAP5 (A Kinase (PRKA) Anchor Protein 5 (AKAP5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKAP5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: AKAP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKAP5 Blocking Peptide, catalog no. 33R-4603, is also available for use as a blocking control in assays to test for specificity of this AKAP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKAP5

Target: AKAP5 (A Kinase (PRKA) Anchor Protein 5 (AKAP5))

Alternative Name: AKAP5 (AKAP5 Products)

Synonyms: AKAP5 antibody, AKAP75 antibody, AKAP79 antibody, H21 antibody, AKAP antibody, P75 antibody, 3526401B18Rik antibody, AKAP 150 antibody, AKAP-5 antibody, AKAP150 antibody, BB098886 antibody, Gm258 antibody, P150 antibody, Akap79 antibody, A kinase (PRKA) anchor protein 5 antibody, A-kinase anchoring protein 5 antibody, AKAP5 antibody, Akap5 antibody

Target Type: Viral Protein

Background: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP5 is a member of the AKAP family. It binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: cAMP Metabolic Process