SNAP23 antibody (N-Term)

Catalog No. ABIN631139

Product Details anti-SNAP23 Antibody

Target: SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNAP23 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SNAP23 antibody was raised against the N terminal of SNAP23

Purification: Affinity purified

Immunogen: SNAP23 antibody was raised using the N terminal of SNAP23 corresponding to a region with amino acids GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNAP23 Blocking Peptide, catalog no. 33R-3332, is also available for use as a blocking control in assays to test for specificity of this SNAP23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAP23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNAP23

Target: SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))

Alternative Name: SNAP23 (SNAP23 Products)

Synonyms: 23kDa antibody, AA408749 antibody, SNAP-23 antibody, Sndt antibody, Syndet antibody, HsT17016 antibody, SNAP23A antibody, SNAP23B antibody, XOSNAP-23 antibody, snap23-A antibody, synaptosome associated protein 23 antibody, synaptosome associated protein 23kDa antibody, synaptosomal-associated protein 23 antibody, synaptosome associated protein 23kDa L homeolog antibody, SNAP23 antibody, snap23 antibody, Snap23 antibody, snap23.L antibody

Background: SNAP23 is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this genepecificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin.

Molecular Weight: 23 kDa (MW of target protein)