PCNP antibody (Middle Region)

Catalog No. ABIN631140

Product Details anti-PCNP Antibody

Target: PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCNP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCNP antibody was raised against the middle region of PCNP

Purification: Affinity purified

Immunogen: PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCNP Blocking Peptide, catalog no. 33R-1302, is also available for use as a blocking control in assays to test for specificity of this PCNP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCNP

Target: PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))

Alternative Name: PCNP (PCNP Products)

Synonyms: 1110018D06Rik antibody, AI647035 antibody, PEST proteolytic signal containing nuclear protein antibody, PCNP antibody, Pcnp antibody

Background: PCNP may be involved in cell cycle regulation.

Molecular Weight: 19 kDa (MW of target protein)