UBE3B antibody (Middle Region)

Catalog No. ABIN631147

This Rabbit Polyclonal antibody specifically detects UBE3B in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for UBE3B antibody (Middle Region) (ABIN631147)

Target: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE3B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE3B Antibody

Binding Specificity: Middle Region

Specificity: UBE3 B antibody was raised against the middle region of UBE3

Purification: Affinity purified

Immunogen: UBE3 B antibody was raised using the middle region of UBE3 corresponding to a region with amino acids VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE3B Blocking Peptide, (ABIN5616879), is also available for use as a blocking control in assays to test for specificity of this UBE3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE3B

Target: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Alternative Name: UBE3B

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.

Molecular Weight: 123 kDa (MW of target protein)