GLUD1 antibody (N-Term)

Catalog No. ABIN631169

Product Details anti-GLUD1 Antibody

Target: GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLUD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLUD1 antibody was raised against the N terminal of GLUD1

Purification: Affinity purified

Immunogen: GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLUD1 Blocking Peptide, catalog no. 33R-2427, is also available for use as a blocking control in assays to test for specificity of this GLUD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLUD1

Target: GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))

Alternative Name: GLUD1 (GLUD1 Products)

Synonyms: GDH antibody, gdh1 antibody, GDH 1 antibody, glud1 antibody, GLUD1 antibody, cb719 antibody, wu:fb16e02 antibody, wu:fb58f12 antibody, wu:fe37f03 antibody, wu:fj43f02 antibody, zgc:192851 antibody, zgc:55630 antibody, GDH1 antibody, GLUD antibody, AI118167 antibody, Gdh-X antibody, Glud antibody, Gludl antibody, Ac2-281 antibody, Gdh1 antibody, Gludeha antibody, MRG-2 antibody, GLUTAMATE DECARBOXYLASE 1 antibody, GLUTAMATE DEHYDROGENASE 1 antibody, MRG7.13 antibody, MRG7_13 antibody, glutamate dehydrogenase 1 antibody, C2H1orf130 antibody, legdh1 antibody, cb622 antibody, wu:fc33g09 antibody, wu:fc66a10 antibody, zgc:77186 antibody, glutamate dehydrogenase 1 antibody, glutamate dehydrogenase 1 S homeolog antibody, glutamate dehydrogenase 1, mitochondrial antibody, glutamate dehydrogenase 1b antibody, glutamate dehydrogenase antibody, non-compact myelin associated protein antibody, glutamate dehydrogenase 1a antibody, GLUD1 antibody, GDH1 antibody, glud1 antibody, glud1.S antibody, LOC693461 antibody, glud1b antibody, Glud1 antibody, HACJB3_RS00320 antibody, LOC100587725 antibody, NCMAP antibody, gdh1 antibody, glud1a antibody

Background: L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Warburg Effect