GALT antibody (C-Term)

Catalog No. ABIN631216

Product Details anti-GALT Antibody

Target: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GALT antibody was raised against the C terminal of GALT

Purification: Affinity purified

Immunogen: GALT antibody was raised using the C terminal of GALT corresponding to a region with amino acids LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALT Blocking Peptide, catalog no. 33R-5189, is also available for use as a blocking control in assays to test for specificity of this GALT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALT

Target: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Alternative Name: GALT (GALT Products)

Synonyms: GALT antibody, AW553376 antibody, CG9232 antibody, Dmel\\CG9232 antibody, dGALT antibody, galactose-1-phosphate uridylyltransferase antibody, galactose-1-phosphate uridylyltransferase, GalT antibody, probable galactose-1-phosphate uridylyltransferase galtb [second part] antibody, UDP-glucose--galactose-1-phosphate uridylyltransferase antibody, GalT galactose-1-phosphate uridylyltransferase antibody, galactose-1-phosphate uridyl transferase antibody, Galactose-1-phosphate uridylyltransferase antibody, galactose-1-phosphate uridylyltransferase S homeolog antibody, GALT antibody, galT antibody, Galt antibody, CNM00620 antibody, Mrub_2813 antibody, Mesil_2395 antibody, Trad_0989 antibody, Igag_1846 antibody, VDIS_RS10425 antibody, Intca_2810 antibody, Marky_2157 antibody, Selsp_1876 antibody, Trebr_2368 antibody, Halhy_5538 antibody, Theth_1357 antibody, galt.S antibody

Background: Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet.

Molecular Weight: 43 kDa (MW of target protein)