MTMR12 antibody (Middle Region)

Catalog No. ABIN631233

The Rabbit Polyclonal anti-MTMR12 antibody (ABIN631233) specifically detects MTMR12 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for MTMR12 antibody (Middle Region) (ABIN631233)

Target: MTMR12 (Myotubularin Related Protein 12 (MTMR12))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTMR12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MTMR12 Antibody

Binding Specificity: Middle Region

Specificity: MTMR12 antibody was raised against the middle region of MTMR12

Purification: Affinity purified

Immunogen: MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTMR12 Blocking Peptide, (ABIN5614873), is also available for use as a blocking control in assays to test for specificity of this MTMR12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTMR12

Target: MTMR12 (Myotubularin Related Protein 12 (MTMR12))

Alternative Name: MTMR12

Background: MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes.

Molecular Weight: 86 kDa (MW of target protein)