MAP2K3 antibody (C-Term)
-
- Target See all MAP2K3 Antibodies
- MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAP2K3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAP2 K3 antibody was raised against the C terminal of MAP2 3
- Purification
- Affinity purified
- Immunogen
- MAP2 K3 antibody was raised using the C terminal of MAP2 3 corresponding to a region with amino acids EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKK
- Top Product
- Discover our top product MAP2K3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAP2K3 Blocking Peptide, catalog no. 33R-2380, is also available for use as a blocking control in assays to test for specificity of this MAP2K3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))
- Alternative Name
- MAP2K3 (MAP2K3 Products)
- Synonyms
- MAPKK3 antibody, MEK3 antibody, MKK3 antibody, PRKMK3 antibody, SAPKK-2 antibody, SAPKK2 antibody, AW212142 antibody, Prkmk3 antibody, mMKK3b antibody, Mkk3 antibody, mitogen-activated protein kinase kinase 3 antibody, mitogen activated protein kinase kinase 3 antibody, MAP kinase activator XMEK3 antibody, MAP2K3 antibody, Map2k3 antibody, map2k3 antibody
- Background
- MAP2K3 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- MAPK Signaling, TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2
-