PFAS antibody

Catalog No. ABIN631263

This anti-PFAS antibody is a Rabbit Polyclonal antibody detecting PFAS in WB. Suitable for Human.

Quick Overview for PFAS antibody (ABIN631263)

Target: PFAS (Phosphoribosylformylglycinamidine Synthase (PFAS))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PFAS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PFAS Antibody

Purification: Affinity purified

Immunogen: PFAS antibody was raised using a synthetic peptide corresponding to a region with amino acids ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PFAS Blocking Peptide, (ABIN938117), is also available for use as a blocking control in assays to test for specificity of this PFAS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PFAS

Target: PFAS (Phosphoribosylformylglycinamidine Synthase (PFAS))

Alternative Name: PFAS

Background: Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis.

Molecular Weight: 145 kDa (MW of target protein)