DDIT4L antibody (Middle Region)

Catalog No. ABIN631272

Product Details anti-DDIT4L Antibody

Target: DDIT4L (DNA-Damage-Inducible Transcript 4-Like (DDIT4L))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDIT4L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DDIT4 L antibody was raised against the middle region of DDIT4

Purification: Affinity purified

Immunogen: DDIT4 L antibody was raised using the middle region of DDIT4 corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDIT4L Blocking Peptide, catalog no. 33R-4509, is also available for use as a blocking control in assays to test for specificity of this DDIT4L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDIT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDIT4L

Target: DDIT4L (DNA-Damage-Inducible Transcript 4-Like (DDIT4L))

Alternative Name: DDIT4L (DDIT4L Products)

Synonyms: 1700037B15Rik antibody, 1700108M02Rik antibody, REDD2 antibody, RTP801L antibody, Smhs1 antibody, Rtp801L antibody, DNA-damage-inducible transcript 4-like antibody, DNA damage inducible transcript 4 like antibody, Ddit4l antibody, DDIT4L antibody, ddit4l antibody

Background: DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.

Molecular Weight: 22 kDa (MW of target protein)