TYMS antibody (C-Term)

Catalog No. ABIN631290

This anti-TYMS antibody is a Rabbit Polyclonal antibody detecting TYMS in WB. Suitable for Human, Mouse and Rat.

Quick Overview for TYMS antibody (C-Term) (ABIN631290)

Target: TYMS (Thymidylate Synthetase (TYMS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TYMS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TYMS Antibody

Binding Specificity: C-Term

Specificity: TYMS antibody was raised against the C terminal of TYMS

Purification: Affinity purified

Immunogen: TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TYMS Blocking Peptide, (ABIN939139), is also available for use as a blocking control in assays to test for specificity of this TYMS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYMS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TYMS

Target: TYMS (Thymidylate Synthetase (TYMS))

Alternative Name: TYMS

Background: TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases