Cortactin antibody (N-Term)

Catalog No. ABIN631298

The Rabbit Polyclonal anti-Cortactin antibody has been validated for WB. It is suitable to detect Cortactin in samples from Human, Mouse and Rat.

Quick Overview for Cortactin antibody (N-Term) (ABIN631298)

Target: Cortactin (CTTN)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cortactin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cortactin Antibody

Binding Specificity: N-Term

Specificity: Cortactin antibody was raised against the N terminal of CTTN

Purification: Affinity purified

Immunogen: Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cortactin Blocking Peptide, (ABIN939797), is also available for use as a blocking control in assays to test for specificity of this Cortactin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cortactin

Target: Cortactin (CTTN)

Alternative Name: Cortactin

Background: CTTN is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. CTTN is localized in the cytoplasm and in areas of the cell-substratum contacts. It has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: MAPK Signaling