UBE2L6 antibody (Middle Region)

Catalog No. ABIN631352

Product Details anti-UBE2L6 Antibody

Target: UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2L6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UBE2 L6 antibody was raised against the middle region of UBE2 6

Purification: Affinity purified

Immunogen: UBE2 L6 antibody was raised using the middle region of UBE2 6 corresponding to a region with amino acids QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2L6 Blocking Peptide, catalog no. 33R-7777, is also available for use as a blocking control in assays to test for specificity of this UBE2L6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2L6

Target: UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))

Alternative Name: UBE2L6 (UBE2L6 Products)

Synonyms: UBE2L6 antibody, RIG-B antibody, UBCH8 antibody, 2810489I21Rik antibody, Ubce8 antibody, Ubcm8 antibody, UbcM8 antibody, ubiquitin conjugating enzyme E2 L6 antibody, ubiquitin-conjugating enzyme E2L 6 antibody, UBE2L6 antibody, Ube2l6 antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L6 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene.

Molecular Weight: 18 kDa (MW of target protein)