RNF25 antibody (Middle Region)

Catalog No. ABIN631379

Product Details anti-RNF25 Antibody

Target: RNF25 (Ring Finger Protein 25 (RNF25))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF25 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RNF25 antibody was raised against the middle region of RNF25

Purification: Affinity purified

Immunogen: RNF25 antibody was raised using the middle region of RNF25 corresponding to a region with amino acids CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF25 Blocking Peptide, catalog no. 33R-1793, is also available for use as a blocking control in assays to test for specificity of this RNF25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF25

Target: RNF25 (Ring Finger Protein 25 (RNF25))

Alternative Name: RNF25 (RNF25 Products)

Synonyms: AO7 antibody, 0610009H16Rik antibody, ring finger protein 25 antibody, RNF25 antibody, Rnf25 antibody

Background: RNF25 contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.

Molecular Weight: 51 kDa (MW of target protein)