SIRT5 antibody (Middle Region)

Catalog No. ABIN631515

The Rabbit Polyclonal anti-SIRT5 antibody (ABIN631515) specifically detects SIRT5 in WB. The antibody is reactive with Human samples.

Quick Overview for SIRT5 antibody (Middle Region) (ABIN631515)

Target: SIRT5 (Sirtuin 5 (SIRT5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIRT5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SIRT5 Antibody

Binding Specificity: Middle Region

Specificity: SIRT5 antibody was raised against the middle region of SIRT5

Purification: Affinity purified

Immunogen: SIRT5 antibody was raised using the middle region of SIRT5 corresponding to a region with amino acids PICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIRT5 Blocking Peptide, (ABIN5616160), is also available for use as a blocking control in assays to test for specificity of this SIRT5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIRT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIRT5

Target: SIRT5 (Sirtuin 5 (SIRT5))

Alternative Name: SIRT5

Background: SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing. and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome