FNTA antibody (N-Term)

Catalog No. ABIN631529

The Rabbit Polyclonal anti-FNTA antibody is suitable to detect FNTA in samples from Human. It has been validated for WB.

Quick Overview for FNTA antibody (N-Term) (ABIN631529)

Target: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FNTA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FNTA Antibody

Binding Specificity: N-Term

Specificity: FNTA antibody was raised against the N terminal of FNTA

Purification: Affinity purified

Immunogen: FNTA antibody was raised using the N terminal of FNTA corresponding to a region with amino acids MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FNTA Blocking Peptide, (ABIN5613630), is also available for use as a blocking control in assays to test for specificity of this FNTA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FNTA

Target: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Alternative Name: FNTA

Background: Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Regulation of G-Protein Coupled Receptor Protein Signaling