GAPDHS antibody (N-Term)

Catalog No. ABIN631607

The Rabbit Polyclonal anti-GAPDHS antibody has been validated for WB. It is suitable to detect GAPDHS in samples from Human.

Quick Overview for GAPDHS antibody (N-Term) (ABIN631607)

Target: GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAPDHS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GAPDHS Antibody

Binding Specificity: N-Term

Specificity: GAPDHS antibody was raised against the N terminal of GAPDHS

Purification: Affinity purified

Immunogen: GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAPDHS Blocking Peptide, (ABIN5613726), is also available for use as a blocking control in assays to test for specificity of this GAPDHS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDHS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GAPDHS

Target: GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))

Alternative Name: GAPDHS

Background: GAPDHS is a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process