HAO1 antibody

Catalog No. ABIN631675

Product Details anti-HAO1 Antibody

Target: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAO1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAO1 Blocking Peptide, catalog no. 33R-3411, is also available for use as a blocking control in assays to test for specificity of this HAO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAO1

Target: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Alternative Name: HAO1 (HAO1 Products)

Synonyms: hao1 antibody, GOX antibody, GOX1 antibody, HAOX1 antibody, Gox1 antibody, XDH1 antibody, Hao-1 antibody, hydroxyacid oxidase 1 antibody, hydroxyacid oxidase (glycolate oxidase) 1 antibody, hydroxyacid oxidase (glycolate oxidase) 1 L homeolog antibody, hydroxyacid oxidase 1, liver antibody, CpipJ_CPIJ013711 antibody, THEYE_A0075 antibody, hao1 antibody, HAO1 antibody, hao1.L antibody, Hao1 antibody

Background: Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process