HAO1 antibody

Catalog No. ABIN631675

This Rabbit Polyclonal antibody specifically detects HAO1 in WB. It exhibits reactivity toward Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for HAO1 antibody (ABIN631675)

Target: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAO1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HAO1 Antibody

Purification: Affinity purified

Immunogen: HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAO1 Blocking Peptide, (ABIN938797), is also available for use as a blocking control in assays to test for specificity of this HAO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAO1

Target: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Alternative Name: HAO1

Background: Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process