GNB1 antibody

Catalog No. ABIN631690

This Rabbit Polyclonal antibody specifically detects GNB1 in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for GNB1 antibody (ABIN631690)

Target: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GNB1 Antibody

Purification: Affinity purified

Immunogen: GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNB1 Blocking Peptide, (ABIN5613810), is also available for use as a blocking control in assays to test for specificity of this GNB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNB1

Target: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Alternative Name: GNB1

Background: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling, SARS-CoV-2 Protein Interactome