WDR35 antibody (N-Term)

Catalog No. ABIN631708

Product Details anti-WDR35 Antibody

Target: WDR35 (WD Repeat Domain 35 (WDR35))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR35 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR35 antibody was raised against the N terminal of WDR35

Purification: Affinity purified

Immunogen: WDR35 antibody was raised using the N terminal of WDR35 corresponding to a region with amino acids SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR35 Blocking Peptide, catalog no. 33R-8495, is also available for use as a blocking control in assays to test for specificity of this WDR35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR35

Target: WDR35 (WD Repeat Domain 35 (WDR35))

Alternative Name: WDR35 (WDR35 Products)

Synonyms: 4930459M12Rik antibody, 4931430C06 antibody, mKIAA1336 antibody, RGD1564116 antibody, Wdr35 antibody, CED2 antibody, IFT121 antibody, im:7159945 antibody, si:ch211-206k20.4 antibody, WD repeat domain 35 antibody, Wdr35 antibody, WDR35 antibody, wdr35 antibody

Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.

Molecular Weight: 132 kDa (MW of target protein)

Pathways: Hedgehog Signaling