RCC2 antibody (Middle Region)
-
- Target See all RCC2 Antibodies
- RCC2 (Regulator of Chromosome Condensation 2 (RCC2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RCC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RCC2 antibody was raised against the middle region of RCC2
- Purification
- Affinity purified
- Immunogen
- RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT
- Top Product
- Discover our top product RCC2 Primary Antibody
-
anti-Regulator of Chromosome Condensation 2 (RCC2) antibody
RCC2 Reactivity: Human WB, IP, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (C-Term) antibodyRCC2 Reactivity: Human, Mouse, Rat WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 441-522) antibodyRCC2 Reactivity: Human, Pig WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 169-198) antibodyRCC2 Reactivity: Human WB Host: Rabbit Polyclonal RB40305 unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 108-157) antibodyRCC2 Reactivity: Human, Mouse, Pig, Rat, Dog, Horse, Cow, Rabbit, Guinea Pig, Bat, Chicken, Monkey, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 431-480) antibodyRCC2 Reactivity: Human, Mouse, Pig, Rat, Dog, Horse, Cow, Rabbit, Guinea Pig, Zebrafish (Danio rerio), Bat, Chicken, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 323-522) antibodyRCC2 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (C-Term) antibodyRCC2 Reactivity: Human, Mouse WB, IHC, IP Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RCC2 Blocking Peptide, catalog no. 33R-7978, is also available for use as a blocking control in assays to test for specificity of this RCC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RCC2 (Regulator of Chromosome Condensation 2 (RCC2))
- Alternative Name
- RCC2 (RCC2 Products)
- Synonyms
- RCC2 antibody, TD-60 antibody, 2610510H01Rik antibody, 2610529N02Rik antibody, AA536646 antibody, AA675016 antibody, Td60 antibody, mKIAA1470 antibody, td-60 antibody, wu:fb36a03 antibody, zgc:77115 antibody, RGD1309986 antibody, regulator of chromosome condensation 2 antibody, regulator of chromosome condensation 2 L homeolog antibody, RCC2 antibody, Rcc2 antibody, rcc2 antibody, rcc2.L antibody
- Background
- RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.
- Molecular Weight
- 56 kDa (MW of target protein)
-
