MPV17L antibody (N-Term)

Catalog No. ABIN631809

Product Details anti-MPV17L Antibody

Target: MPV17L (MPV17 Mitochondrial Membrane Protein-Like (MPV17L))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPV17L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MPV17 L antibody was raised against the N terminal of MPV17

Purification: Affinity purified

Immunogen: MPV17 L antibody was raised using the N terminal of MPV17 corresponding to a region with amino acids MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPV17L Blocking Peptide, catalog no. 33R-5673, is also available for use as a blocking control in assays to test for specificity of this MPV17L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPV10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPV17L

Target: MPV17L (MPV17 Mitochondrial Membrane Protein-Like (MPV17L))

Alternative Name: MPV17L (MPV17L Products)

Synonyms: Mpv17 antibody, M-LPH antibody, MLPH1 antibody, MLPH2 antibody, MPV17L1 antibody, M-LP antibody, MpV17 mitochondrial inner membrane protein antibody, MPV17 mitochondrial membrane protein-like S homeolog antibody, mpv17-like protein antibody, MPV17 mitochondrial membrane protein-like antibody, MPV17 mitochondrial inner membrane protein like antibody, Mpv17 transgene, kidney disease mutant-like antibody, Mpv17 antibody, mpv17l.S antibody, LOC465114 antibody, LOC100158680 antibody, MPV17L antibody, Mpv17l antibody

Background: Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Sensory Perception of Sound