KRTAP11-1 antibody (N-Term)

Catalog No. ABIN631812

Product Details anti-KRTAP11-1 Antibody

Target: KRTAP11-1 (Keratin Associated Protein 11-1 (KRTAP11-1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRTAP11-1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KAP11.1 antibody was raised against the N terminal of KRTAP11-1

Purification: Affinity purified

Immunogen: KAP11.1 antibody was raised using the N terminal of KRTAP11-1 corresponding to a region with amino acids SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KAP11.1 Blocking Peptide, catalog no. 33R-8433, is also available for use as a blocking control in assays to test for specificity of this KAP11.1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRTAP11-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRTAP11-1

Target: KRTAP11-1 (Keratin Associated Protein 11-1 (KRTAP11-1))

Alternative Name: KAP11.1 (KRTAP11-1 Products)

Synonyms: HACL1 antibody, HACL-1 antibody, KAP11.1 antibody, Hacl1 antibody, PRED29 antibody, AA162070 antibody, AA589467 antibody, AV018433 antibody, keratin associated protein 11-1 antibody, keratin-associated protein 11-1 antibody, KRTAP11-1 antibody, Krtap11-1 antibody, LOC694859 antibody

Background: KRTAP11-1 belongs to the PMG family. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Molecular Weight: 17 kDa (MW of target protein)