TMPRSS3 antibody (N-Term)

Catalog No. ABIN631830

Product Details anti-TMPRSS3 Antibody

Target: TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMPRSS3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMPRSS3 antibody was raised against the N terminal of TMPRSS3

Purification: Affinity purified

Immunogen: TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMPRSS3 Blocking Peptide, catalog no. 33R-6022, is also available for use as a blocking control in assays to test for specificity of this TMPRSS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMPRSS3

Target: TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))

Alternative Name: TMPRSS3 (TMPRSS3 Products)

Synonyms: TMPRSS3 antibody, DKFZp469L1528 antibody, DFNB10 antibody, DFNB8 antibody, ECHOS1 antibody, TADG12 antibody, transmembrane protease, serine 3 antibody, TMPRSS3 antibody, Tmprss3 antibody

Background: This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Sensory Perception of Sound