KRT8 antibody (N-Term)

Catalog No. ABIN631865

The Rabbit Polyclonal anti-KRT8 antibody has been validated for WB and IHC. It is suitable to detect KRT8 in samples from Human.

Quick Overview for KRT8 antibody (N-Term) (ABIN631865)

Target: KRT8 (Keratin 8 (KRT8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRT8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-KRT8 Antibody

Binding Specificity: N-Term

Specificity: Cytokeratin 8 antibody was raised against the N terminal of KRT8

Purification: Affinity purified

Immunogen: Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 8 Blocking Peptide, (ABIN5613110), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRT8

Target: KRT8 (Keratin 8 (KRT8))

Alternative Name: Cytokeratin 8

Background: KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.

Molecular Weight: 53 kDa (MW of target protein)