ERCC5 antibody (N-Term)

Catalog No. ABIN631899

This anti-ERCC5 antibody is a Rabbit Polyclonal antibody detecting ERCC5 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ERCC5 antibody (N-Term) (ABIN631899)

Target: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERCC5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ERCC5 Antibody

Binding Specificity: N-Term

Specificity: ERCC5 antibody was raised against the N terminal of ERCC5

Purification: Affinity purified

Immunogen: ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERCC5 Blocking Peptide, (ABIN5613393), is also available for use as a blocking control in assays to test for specificity of this ERCC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERCC5

Target: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Alternative Name: ERCC5

Background: Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage.

Molecular Weight: 133 kDa (MW of target protein)

Pathways: DNA Damage Repair