ERCC5 antibody (N-Term)
-
- Target See all ERCC5 Antibodies
- ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERCC5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ERCC5 antibody was raised against the N terminal of ERCC5
- Purification
- Affinity purified
- Immunogen
- ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ
- Top Product
- Discover our top product ERCC5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ERCC5 Blocking Peptide, catalog no. 33R-6828, is also available for use as a blocking control in assays to test for specificity of this ERCC5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))
- Alternative Name
- ERCC5 (ERCC5 Products)
- Background
- Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage.
- Molecular Weight
- 133 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-