ICA1 antibody (N-Term)

Catalog No. ABIN631932

Product Details anti-ICA1 Antibody

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ICA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ICA1 antibody was raised against the N terminal of ICA1

Purification: Affinity purified

Immunogen: ICA1 antibody was raised using the N terminal of ICA1 corresponding to a region with amino acids SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ICA1 Blocking Peptide, catalog no. 33R-8545, is also available for use as a blocking control in assays to test for specificity of this ICA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ICA1

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Alternative Name: ICA1 (ICA1 Products)

Synonyms: ica1 antibody, MGC52730 antibody, ICA1 antibody, DKFZp469G0321 antibody, zgc:92566 antibody, 69kDa antibody, ICA69 antibody, Ica69 antibody, MGC83241 antibody, ICAp69 antibody, islet cell autoantigen 1 L homeolog antibody, islet cell autoantigen 1 antibody, Islet cell autoantigen 1 antibody, islet cell autoantigen 1 S homeolog antibody, ica1.L antibody, ICA1 antibody, ica1 antibody, ica69 antibody, Ica1 antibody, ica1.S antibody

Background: ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome.

Molecular Weight: 55 kDa (MW of target protein)