NECAB3 antibody (Middle Region)

Catalog No. ABIN632068

Product Details anti-NECAB3 Antibody

Target: NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NECAB3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NECAB3 antibody was raised against the middle region of NECAB3

Purification: Affinity purified

Immunogen: NECAB3 antibody was raised using the middle region of NECAB3 corresponding to a region with amino acids ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NECAB3 Blocking Peptide, catalog no. 33R-2749, is also available for use as a blocking control in assays to test for specificity of this NECAB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NECAB3

Target: NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))

Alternative Name: NECAB3 (NECAB3 Products)

Synonyms: Apba2bp antibody, APBA2BP antibody, NECAB3 antibody, EFCBP3 antibody, NIP1 antibody, STIP3 antibody, SYTIP2 antibody, XB51 antibody, dJ63M2.4 antibody, dJ63M2.5 antibody, 2900010M17Rik antibody, AI853434 antibody, Nip1 antibody, N-terminal EF-hand calcium binding protein 3 antibody, Necab3 antibody, NECAB3 antibody

Background: The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 44 kDa (MW of target protein)