PRRC2B antibody (N-Term)

Catalog No. ABIN632176

Product Details anti-PRRC2B Antibody

Target: PRRC2B (Proline-Rich Coiled-Coil 2B (PRRC2B))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRRC2B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA0515 antibody was raised against the N terminal of KIAA0515

Purification: Affinity purified

Immunogen: KIAA0515 antibody was raised using the N terminal of KIAA0515 corresponding to a region with amino acids ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0515 Blocking Peptide, catalog no. 33R-1551, is also available for use as a blocking control in assays to test for specificity of this KIAA0515 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0515 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRRC2B

Target: PRRC2B (Proline-Rich Coiled-Coil 2B (PRRC2B))

Alternative Name: KIAA0515 (PRRC2B Products)

Synonyms: BAT2L antibody, BAT2L1 antibody, KIAA0515 antibody, LQFBS-1 antibody, 5830434P21Rik antibody, AI173903 antibody, Bat2l antibody, Bat2l1 antibody, D430039P21 antibody, mKIAA0515 antibody, proline rich coiled-coil 2B antibody, proline-rich coiled-coil 2B antibody, PRRC2B antibody, Prrc2b antibody

Background: The function of KIAA0515 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome