Choline Kinase alpha antibody (Middle Region)

Catalog No. ABIN632201

The Rabbit Polyclonal anti-Choline Kinase alpha antibody has been validated for WB. It is suitable to detect Choline Kinase alpha in samples from Human, Mouse and Rat.

Quick Overview for Choline Kinase alpha antibody (Middle Region) (ABIN632201)

Target: Choline Kinase alpha (CHKA)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Choline Kinase alpha antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Choline Kinase alpha Antibody

Binding Specificity: Middle Region

Specificity: CHKA antibody was raised against the middle region of CHKA

Purification: Affinity purified

Immunogen: CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHKA Blocking Peptide, (ABIN940315), is also available for use as a blocking control in assays to test for specificity of this CHKA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHKA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Choline Kinase alpha

Target: Choline Kinase alpha (CHKA)

Alternative Name: CHKA

Background: The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.

Molecular Weight: 50 kDa (MW of target protein)