RPS6KB1 antibody (N-Term)

Catalog No. ABIN632265

This anti-RPS6KB1 antibody is a Rabbit Polyclonal antibody detecting RPS6KB1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RPS6KB1 antibody (N-Term) (ABIN632265)

Target: RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS6KB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPS6KB1 Antibody

Binding Specificity: N-Term

Specificity: RPS6 KB1 antibody was raised against the N terminal of RPS6 B1

Purification: Affinity purified

Immunogen: RPS6 KB1 antibody was raised using the N terminal of RPS6 B1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS6KB1 Blocking Peptide, (ABIN5615952), is also available for use as a blocking control in assays to test for specificity of this RPS6KB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 B1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS6KB1

Target: RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))

Alternative Name: RPS6KB1

Background: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, RTK Signaling, AMPK Signaling, Regulation of Cell Size, Skeletal Muscle Fiber Development, Feeding Behaviour, G-protein mediated Events, Smooth Muscle Cell Migration, Interaction of EGFR with phospholipase C-gamma, Warburg Effect