ALKBH3 antibody

Catalog No. ABIN632277

The Rabbit Polyclonal anti-ALKBH3 antibody (ABIN632277) specifically detects ALKBH3 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for ALKBH3 antibody (ABIN632277)

Target: ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALKBH3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALKBH3 Antibody

Purification: Affinity purified

Immunogen: ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALKBH3 Blocking Peptide, (ABIN937979), is also available for use as a blocking control in assays to test for specificity of this ALKBH3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALKBH3

Target: ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))

Alternative Name: ALKBH3

Background: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: DNA Damage Repair