GORASP1 antibody (N-Term)

Catalog No. ABIN632290

Product Details anti-GORASP1 Antibody

Target: GORASP1 (Golgi Reassembly Stacking Protein 1, 65kDa (GORASP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GORASP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GORASP1 antibody was raised against the N terminal of GORASP1

Purification: Affinity purified

Immunogen: GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GORASP1 Blocking Peptide, catalog no. 33R-7444, is also available for use as a blocking control in assays to test for specificity of this GORASP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GORASP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GORASP1

Target: GORASP1 (Golgi Reassembly Stacking Protein 1, 65kDa (GORASP1))

Alternative Name: GORASP1 (GORASP1 Products)

Synonyms: MGC69226 antibody, MGC134531 antibody, 5430411C10Rik antibody, GOLPH5 antibody, GRASP65 antibody, P65 antibody, cb744 antibody, zgc:101588 antibody, golgi reassembly stacking protein 1 antibody, golgi perepheral membrane protein p65 antibody, golgi reassembly stacking protein 1a antibody, GORASP1 antibody, gorasp1 antibody, PTRG_03298 antibody, PY00200 antibody, Gorasp1 antibody, gorasp1a antibody

Background: The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome