Proline Rich 13 antibody (N-Term)

Catalog No. ABIN632293

Product Details anti-Proline Rich 13 Antibody

Target: Proline Rich 13 (PRR13)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Proline Rich 13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRR13 antibody was raised against the N terminal of PRR13

Purification: Affinity purified

Immunogen: PRR13 antibody was raised using the N terminal of PRR13 corresponding to a region with amino acids MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRR13 Blocking Peptide, catalog no. 33R-6618, is also available for use as a blocking control in assays to test for specificity of this PRR13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Proline Rich 13

Target: Proline Rich 13 (PRR13)

Alternative Name: PRR13 (PRR13 Products)

Synonyms: MGC133876 antibody, TXR1 antibody, 1110020C13Rik antibody, 2010324E22Rik antibody, RGD1307129 antibody, proline rich 13 antibody, PRR13 antibody, Prr13 antibody

Background: PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.

Molecular Weight: 15 kDa (MW of target protein)