Desmin antibody (Middle Region)

Catalog No. ABIN632380

Product Details anti-Desmin Antibody

Target: Desmin (DES)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Desmin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Desmin antibody was raised against the middle region of DES

Purification: Affinity purified

Immunogen: Desmin antibody was raised using the middle region of DES corresponding to a region with amino acids MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Desmin Blocking Peptide, catalog no. 33R-5684, is also available for use as a blocking control in assays to test for specificity of this Desmin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Desmin

Target: Desmin (DES)

Alternative Name: Desmin (DES Products)

Synonyms: DES antibody, des-b antibody, MGC80853 antibody, des antibody, csm1 antibody, csm2 antibody, desm antibody, cmd1i antibody, MGC75911 antibody, LOC100220724 antibody, desmin antibody, cb290 antibody, fb59a12 antibody, wu:fb59a12 antibody, zgc:109859 antibody, CSM1 antibody, CSM2 antibody, LGMD2R antibody, wu:fc11d08 antibody, zgc:154009 antibody, des-a antibody, MGC52614 antibody, desmin antibody, desmin, gene 1 L homeolog antibody, desmin, gene 1 antibody, desmin a antibody, desmin b antibody, desmin, gene 1 S homeolog antibody, desmin, gene 2 S homeolog antibody, DES antibody, des.1.L antibody, des.1 antibody, des antibody, desma antibody, Des antibody, desmb antibody, des.1.S antibody, des.2.S antibody

Background: DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Molecular Weight: 53 kDa (MW of target protein)