COPG antibody (N-Term)

Catalog No. ABIN632383

This Rabbit Polyclonal antibody specifically detects COPG in WB. It exhibits reactivity toward Human.

Quick Overview for COPG antibody (N-Term) (ABIN632383)

Target: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COPG antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-COPG Antibody

Binding Specificity: N-Term

Specificity: COPG antibody was raised against the N terminal of COPG

Purification: Affinity purified

Immunogen: COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COPG Blocking Peptide, (ABIN5612962), is also available for use as a blocking control in assays to test for specificity of this COPG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COPG

Target: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Alternative Name: COPG

Background: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Molecular Weight: 98 kDa (MW of target protein)