TPPP3 antibody (N-Term)

Catalog No. ABIN632414

The Rabbit Polyclonal anti-TPPP3 antibody has been validated for WB. It is suitable to detect TPPP3 in samples from Human.

Quick Overview for TPPP3 antibody (N-Term) (ABIN632414)

Target: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPPP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TPPP3 Antibody

Binding Specificity: N-Term

Specificity: TPPP3 antibody was raised against the N terminal of TPPP3

Purification: Affinity purified

Immunogen: TPPP3 antibody was raised using the N terminal of TPPP3 corresponding to a region with amino acids MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPPP3 Blocking Peptide, (ABIN5616742), is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPPP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPPP3

Target: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Alternative Name: TPPP3

Background: TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.

Molecular Weight: 19 kDa (MW of target protein)