TPPP3 antibody (Middle Region)
-
- Target See all TPPP3 Antibodies
- TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TPPP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TPPP3 antibody was raised against the middle region of TPPP3
- Purification
- Affinity purified
- Immunogen
- TPPP3 antibody was raised using the middle region of TPPP3 corresponding to a region with amino acids PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD
- Top Product
- Discover our top product TPPP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TPPP3 Blocking Peptide, catalog no. 33R-6969, is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPPP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))
- Alternative Name
- TPPP3 (TPPP3 Products)
- Synonyms
- p20 antibody, p25gamma antibody, 2700055K07Rik antibody, CGI-38 antibody, Ceacam9 antibody, mmCGM8 antibody, RGD1305061 antibody, tubulin polymerization promoting protein family member 3 antibody, tubulin polymerization-promoting protein family member 3 antibody, tubulin polymerization-promoting protein family member 3 L homeolog antibody, TPPP3 antibody, Tppp3 antibody, tppp3.L antibody
- Background
- TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.
- Molecular Weight
- 19 kDa (MW of target protein)
-