FAM135B antibody (Middle Region)

Catalog No. ABIN632470

This Rabbit Polyclonal antibody specifically detects FAM135B in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for FAM135B antibody (Middle Region) (ABIN632470)

Target: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM135B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM135B Antibody

Binding Specificity: Middle Region

Specificity: FAM135 B antibody was raised against the middle region of FAM135

Purification: Affinity purified

Immunogen: FAM135 B antibody was raised using the middle region of FAM135 corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM135B Blocking Peptide, (ABIN5613471), is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM135B

Target: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Alternative Name: FAM135B

Background: The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 156 kDa (MW of target protein)