FAM135B antibody (Middle Region)

Catalog No. ABIN632470

Product Details anti-FAM135B Antibody

Target: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM135B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM135 B antibody was raised against the middle region of FAM135

Purification: Affinity purified

Immunogen: FAM135 B antibody was raised using the middle region of FAM135 corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM135B Blocking Peptide, catalog no. 33R-9192, is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM135B

Target: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Alternative Name: FAM135B (FAM135B Products)

Synonyms: MGC81353 antibody, C8ORFK32 antibody, RGD1308133 antibody, 1700010C24Rik antibody, A830008O07Rik antibody, family with sequence similarity 135 member B antibody, family with sequence similarity 135 member B L homeolog antibody, family with sequence similarity 135, member B antibody, FAM135B antibody, fam135b.L antibody, Fam135b antibody

Background: The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 156 kDa (MW of target protein)