C2orf30 antibody (Middle Region)

Catalog No. ABIN632582

Product Details anti-C2orf30 Antibody

Target: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C2orf30 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C2 orf30 antibody was raised against the middle region of C2 rf30

Purification: Affinity purified

Immunogen: C2 orf30 antibody was raised using the middle region of C2 rf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C2orf30 Blocking Peptide, catalog no. 33R-3363, is also available for use as a blocking control in assays to test for specificity of this C2orf30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C2orf30

Target: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Alternative Name: C2orf30 (ERLEC1 Products)

Synonyms: C2orf30 antibody, CIM antibody, CL24936 antibody, CL25084 antibody, XTP3-B antibody, XTP3TPB antibody, 4933407N01Rik antibody, endoplasmic reticulum lectin 1 antibody, ERLEC1 antibody, Erlec1 antibody

Background: C2orf30 is a probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome