C2orf30 antibody (Middle Region)

Catalog No. ABIN632582

The Rabbit Polyclonal anti-C2orf30 antibody is suitable to detect C2orf30 in samples from Human. It has been validated for WB.

Quick Overview for C2orf30 antibody (Middle Region) (ABIN632582)

Target: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C2orf30 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C2orf30 Antibody

Binding Specificity: Middle Region

Specificity: C2 orf30 antibody was raised against the middle region of C2 rf30

Purification: Affinity purified

Immunogen: C2 orf30 antibody was raised using the middle region of C2 rf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C2orf30 Blocking Peptide, (ABIN938749), is also available for use as a blocking control in assays to test for specificity of this C2orf30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C2orf30

Target: C2orf30 (ERLEC1) (Endoplasmic Reticulum Lectin 1 (ERLEC1))

Alternative Name: C2orf30

Background: C2orf30 is a probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome