PLAT antibody (Middle Region)

Catalog No. ABIN632631

The Rabbit Polyclonal anti-PLAT antibody (ABIN632631) specifically detects PLAT in WB. The antibody is reactive with Human samples.

Quick Overview for PLAT antibody (Middle Region) (ABIN632631)

Target: PLAT (Plasminogen Activator, Tissue (PLAT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLAT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLAT Antibody

Binding Specificity: Middle Region

Specificity: PLAT antibody was raised against the middle region of PLAT

Purification: Affinity purified

Immunogen: PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLAT Blocking Peptide, (ABIN5615407), is also available for use as a blocking control in assays to test for specificity of this PLAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLAT

Target: PLAT (Plasminogen Activator, Tissue (PLAT))

Alternative Name: PLAT

Background: This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Autophagy, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, SARS-CoV-2 Protein Interactome