TBC1D24 antibody (Middle Region)

Catalog No. ABIN632637

This anti-TBC1D24 antibody is a Rabbit Polyclonal antibody detecting TBC1D24 in WB. Suitable for Human.

Quick Overview for TBC1D24 antibody (Middle Region) (ABIN632637)

Target: TBC1D24 (TBC1 Domain Family, Member 24 (TBC1D24))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBC1D24 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TBC1D24 Antibody

Binding Specificity: Middle Region

Specificity: TBC1 D24 antibody was raised against the middle region of TBC1 24

Purification: Affinity purified

Immunogen: TBC1 D24 antibody was raised using the middle region of TBC1 24 corresponding to a region with amino acids SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D24 Blocking Peptide, (ABIN5616518), is also available for use as a blocking control in assays to test for specificity of this TBC1D24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBC1D24

Target: TBC1D24 (TBC1 Domain Family, Member 24 (TBC1D24))

Alternative Name: TBC1D24

Background: TBC1D24 may act as a GTPase-activating protein for Rab family proteins.

Molecular Weight: 62 kDa (MW of target protein)