DLG4 antibody

Catalog No. ABIN632653

This Rabbit Polyclonal antibody specifically detects DLG4 in WB. It exhibits reactivity toward Human.

Quick Overview for DLG4 antibody (ABIN632653)

Target: DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLG4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLG4 Antibody

Purification: Affinity purified

Immunogen: DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLG4 Blocking Peptide, (ABIN936248), is also available for use as a blocking control in assays to test for specificity of this DLG4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLG4

Target: DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))

Alternative Name: DLG4

Background: This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 85 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Synaptic Membrane, Skeletal Muscle Fiber Development, Asymmetric Protein Localization, Regulation of long-term Neuronal Synaptic Plasticity