DCMP Deaminase (DCTD) (Middle Region) antibody

Catalog No. ABIN632656

Product Details

Target: DCMP Deaminase (DCTD)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: DCTD antibody was raised against the middle region of DCTD

Purification: Affinity purified

Immunogen: DCTD antibody was raised using the middle region of DCTD corresponding to a region with amino acids MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCTD Blocking Peptide, catalog no. 33R-6407, is also available for use as a blocking control in assays to test for specificity of this DCTD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: DCMP Deaminase (DCTD)

Alternative Name: DCTD (DCTD Products)

Synonyms: zgc:110226 antibody, DCTD antibody, 6030466N05Rik antibody, Afu2g06240 antibody, MGC81193 antibody, dCMP deaminase antibody, deoxycytidylate deaminase antibody, cell division protein DedD antibody, dCMP deaminase L homeolog antibody, conserved uncharacterised protein antibody, DCTD antibody, dctd antibody, dctD antibody, Dctd antibody, AFUA_2G06240 antibody, ACLA_068070 antibody, LELG_03636 antibody, VIBHAR_RS20285 antibody, LOC5564022 antibody, Ccur_00700 antibody, PAAG_00286 antibody, SPAP_0719 antibody, LOC100285892 antibody, dctd.L antibody, CNB00950 antibody, THAPS_42740 antibody, dCMP deaminase antibody, Thena_0587 antibody, Ccan_15560 antibody

Target Type: Viral Protein

Background: The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 21 kDa (MW of target protein)