CDC27 antibody

Catalog No. ABIN632660

Product Details anti-CDC27 Antibody

Target: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDC27 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CDC27 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDC27 Blocking Peptide, catalog no. 33R-4514, is also available for use as a blocking control in assays to test for specificity of this CDC27 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDC27

Target: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Alternative Name: CDC27 (CDC27 Products)

Synonyms: ANAPC3 antibody, APC3 antibody, CDC27Hs antibody, D0S1430E antibody, D17S978E antibody, HNUC antibody, NUC2 antibody, wu:fb54g06 antibody, wu:fc88c12 antibody, AI452358 antibody, BC023187 antibody, CDC27 antibody, NV10210 antibody, cell division cycle 27 antibody, cell division cycle 27 S homeolog antibody, cell division cycle protein 27 homolog antibody, anaphase-promoting complex subunit Apc3 antibody, CDC27 antibody, cdc27 antibody, Cdc27 antibody, cdc27.S antibody, LOC100123129 antibody, nuc2 antibody

Background: The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells.

Molecular Weight: 92 kDa (MW of target protein)