CDC27 antibody

Catalog No. ABIN632660

The Rabbit Polyclonal anti-CDC27 antibody is suitable to detect CDC27 in samples from Human. It has been validated for WB.

Quick Overview for CDC27 antibody (ABIN632660)

Target: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDC27 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CDC27 Antibody

Purification: Affinity purified

Immunogen: CDC27 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDC27 Blocking Peptide, (ABIN939900), is also available for use as a blocking control in assays to test for specificity of this CDC27 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDC27

Target: CDC27 (Cell Division Cycle 27 Homolog (S. Cerevisiae) (CDC27))

Alternative Name: CDC27

Background: The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells.

Molecular Weight: 92 kDa (MW of target protein)