DPH1 antibody

Catalog No. ABIN632695

This Rabbit Polyclonal antibody specifically detects DPH1 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for DPH1 antibody (ABIN632695)

Target: DPH1 (DPH1 Homolog (DPH1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPH1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DPH1 Antibody

Purification: Affinity purified

Immunogen: DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPH1 Blocking Peptide, (ABIN5613244), is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPH1

Target: DPH1 (DPH1 Homolog (DPH1))

Alternative Name: DPH1

Background: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Molecular Weight: 49 kDa (MW of target protein)